PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA39377
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Nin-like
Protein Properties Length: 573aa    MW: 64046.2 Da    PI: 8.0034
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA39377genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK932.1e-29256307152
                     RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GIkRWP+Rkik++
  Tp57577_TGAC_v2_mRNA39377 256 AEKTITLQVLRQYFAGSLKDAAKNIGVCTTTLKRICRQHGIKRWPSRKIKKV 307
                                589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.859246327IPR003035RWP-RK domain
PfamPF020423.6E-25259307IPR003035RWP-RK domain
SuperFamilySSF542775.15E-25470563No hitNo description
Gene3DG3DSA:3.10.20.2402.5E-23476558No hitNo description
SMARTSM006665.9E-24478561IPR000270PB1 domain
PROSITE profilePS5174526.311478561IPR000270PB1 domain
CDDcd064073.57E-41479560No hitNo description
PfamPF005643.7E-19479560IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MHKLPLAQTW ISCIQQGKDG CRHSDDNYAN CISPVEYACY VGDSSVRFFH EACMEHHLLK  60
GQGVAGGAFM TNQPCFSADI TSLSKTDYPL SHHARLFGLR AAVAIRLRSI YSTSDDYVLE  120
FFLPVDCNDS EEQKNMLTSL SMIIQRVCRS LRVITDKELD KDNLPSNEVM AVTDGRFATN  180
AIWSESQHRR MAASLGGEEK LSETMSRKFS EQRRQQETLT LKGDLDCGRA SSPSVEGTFL  240
SSLGINRTGE KRRAKAEKTI TLQVLRQYFA GSLKDAAKNI GVCTTTLKRI CRQHGIKRWP  300
SRKIKKVGHS LQKLQLVIDS VQGASGSFQI DSFYSKFSDL SSPRTSLIST LNQIDNQVSL  360
STLPDPDSLS PEGASKSPSS SCSQSSFSSH SCSSMSEQQH RKGNVAIGNK DPSVGEDSVD  420
VVLKRIRSEA ELKSLIQDNK TKLMPRSQSQ ETLGENPKTE HHKSFLKSAP KASQKEDSHR  480
VKVTFGDEKT RFRLPKNWGY EDLVQEIARR FNVSEMSKFD IKYLDDDYEW VLLTCDADLE  540
ECIDVCQSSE TSTIKLCLQP SSNFIRSSLE FR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013462281.10.0plant regulator RWP-RK family protein
TrEMBLA0A072V3U80.0A0A072V3U8_MEDTR; Plant regulator RWP-RK family protein
STRINGGLYMA04G01910.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.11e-141Nin-like family protein